| General information | |
| ACovPid: | ACoVP100437 |
| Trivial Name: | TP29 (Tat-P29) |
| Amino Acids Sequence: | YGRKKRRQRRRGSGYGGASVCIYCRSRVEHPDVDGLCKLRGKF |
| Length: | 43 |
| C-Terminal Modification: | None |
| N-Terminal Modification: | None |
| Chemical Modification: | None |
| Peptide Source: | Murine coronavirus (strain A59) (MHV-A59) (Murine hepatitis virus) : 11142 |
| Source Description: | The author designed a peptide (TP29) from the sequence of the interaction interface of mouse hepatitis virus (MHV) nsp10 |
| Against Virus: | Murine coronavirus (strain A59) (MHV-A59) (Murine hepatitis virus) : 11142 |
| Inhibition Value Type: | IC50 |
| Inhibitory Effect: | 60.6 |
| Inhibitory Unit: | µM |
| Target Domain Name: | |
| Assay: | Plaque reduction assay |
| Assay Description: | For the measurement of the inhibition of peptides on the virus replication in mouse, groups of mice were infected by i.h. inoculation with 500,000 PFU of MHV-A59, and then the peptide (TP29, TP29M, or TP29S), at a final concentration of 0.5 mg/g of body weight, or PBS (nontreatment control) was injected intrahepatically. Mice for each test group were sacrificed at days 1, 3, 5, and 7 postinfection, and the livers were removed and placed directly into 2 ml of isotonic saline with 0.167% gelatin, weighed, and stored frozen at −70°C until use. For the measurement of ALT/glutamic-pyruvic transaminase (GPT) levels, blood was incubated with serum accelerator at room temperature to allow coagulation and then was centrifuged to obtain serum; the serum was used for measurements of ALT levels using an ALT/GPT kit (C009-2; NJJCBIO). |
| Anti-CoV activity in vivo: | |
| Reference: | 26041293 |
| Comment: | |
| 3D structure: | |
| Structure Experiment Verified: | NO |
| Similar Peptides: | ACoVP100373   ACoVP100372    |