| General information | |
| ACovPid: | ACoVP100363 |
| Trivial Name: | 229E-HR2P |
| Amino Acids Sequence: | VVEQYNQTILNLTSEISTLENKSAELNYTVQKLQTLIDNINSTLVDLKWL |
| Length: | 50 |
| C-Terminal Modification: | None |
| N-Terminal Modification: | None |
| Chemical Modification: | None |
| Peptide Source: | Human coronavirus 229E (HCoV-229E) : 11137 |
| Source Description: | From the heptad repeat region 2 of spike protein of Human coronavirus 229E |
| Against Virus: | Human coronavirus 229E (HCoV-229E) : 11137 |
| Inhibition Value Type: | IC50 |
| Inhibitory Effect: | 0.53 |
| Inhibitory Unit: | µM |
| Target Domain Name: | HR2 domain of HCoV-229E |
| Assay: | Pseudotyped virus infection inhibition assay |
| Assay Description: | Pseudovirus carrying HCoV-229E S protein was constructed, and the HCoV-229E pseudovirus infection assay was developed based on our experience in establishing the MERS-CoV pseudovirus infection assay performed as described previously (PMID: 26164863, 26908211). Briefly, HCoV-229E pseudovirus was generated via cotransfection of 293T cells with an HCoV-229E S protein-expressing plasmid (pcDNA3.1-229E, kindly provided by Fang Li) and a backbone plasmid (pNL4.3-HIV-luc). Cell supernatants were harvested 48 h after transfection and centrifuged at 3000× g at 4 °C for 10 min. To measure the antiviral activities of peptides, peptides to be tested were prepared in 2-fold dilutions and incubated with pseudovirus for 1 h at 37 °C. The virus/peptide mixture was added to Huh-7 cells (10^4 per well). The culture was refed with fresh medium 12 h post-infection and incubated for an additional 48 h at 37 °C. Luciferase activity was measured using luciferase assay reagents (Promega, Madison, WI, USA) and a luminescence counter (Infinite M200PRO, Tecan, NC, USA). The percent inhibition and IC50 values were calculated using the CalcuSyn software (kindly provided by T.C. Chou) [51]. |
| Anti-CoV activity in vivo: | The respiratory tract is a key target of HCoV-229E viral infection [14]. Proteolytic enzymes on the surface of respiratory tract mucosa may cause degradation of the peptides [31,32], resulting in attenuation of their antiviral activity. Therefore, the antiviral activity of 229E-HR2P was verified in the respiratory tract of mice intranasally administered with or without 229E-HR2P. One hour later, upper and lower respiratory tract lavage fluids, respectively, were collected to test their inhibitory activities on HCoV-229E S protein-mediated cell-cell fusion. As shown in Figure 7, the upper and lower respiratory tract lavage fluids from mice treated with 229E-HR2P at 1:32 and 1:16 dilutions, respectively, exhibited significant viral membrane fusion-inhibitory activity. These findings suggested that 229E-HR2P may not be degraded by proteolytic enzymes and that the peptide can maintain effective antiviral activity in both upper and lower respiratory tracts against HCoV-229E infection. |
| Reference: | 29415501 |
| Comment: | 229E-HR1P- and 229E-HR2P-HCoV-229E pseudovirus (PsV) infection in Huh-7 cells; |
| 3D structure: | |
| Structure Experiment Verified: | NO |
| Similar Peptides: | ACoVP100394 ACoVP100395 ACoVP100396 ACoVP100128 ACoVP100183 |
| Target Domain information | |
| Target Domain Full Name: | Heptad repeat 2 (HR2) domain of Human coronavirus 229E (HCoV-229E) spike glycoprotein |
| Target Type: | glycoprotein |
| UniprotID [Sequence]: | P15423 [1031-1127] |
| Target Synonyms: | Alternative name(s) for spike glycoprotein: E2 Peplomer protein S glycoprotein |
| Target Source: | Human coronavirus 229E (HCoV-229E) : 11137 |
| Target Structure: | 5YL9, 5ZHY, 5ZUV, 6ATK, 6U7H, 7CYC, 7CYD |