| General information | |
| ACovPid: | ACoVP100359 |
| Trivial Name: | P9R |
| Amino Acids Sequence: | NGAICWGPCPTAFRQIGNCGRFRVRCCRIR |
| Length: | 30 |
| C-Terminal Modification: | None |
| N-Terminal Modification: | None |
| Chemical Modification: | None |
| Peptide Source: | Mouse β-defensin-4 (mBD4) : 10090 |
| Source Description: | |
| Against Virus: | Severe acute respiratory syndrome coronavirus (SARS-CoV) : 694009 |
| Inhibition Value Type: | IC50 |
| Inhibitory Effect: | 20.2 |
| Inhibitory Unit: | µg/mL |
| Target Domain Name: | |
| Assay: | Plaque reduction assay |
| Assay Description: | Peptides (P9R, P9RS and 8P9R) were synthesized by ChinaPeptide. Antiviral activity of peptides was measured using a plaque reduction assay. Briefly, peptides were dissolved in PBS or 30 mM PB containing 24.6 mM Na2HPO4 and 5.6 mM KH2PO4 at a pH of 7.4. Peptides or bovine serum albumin (BSA, 0.2–25.0 µg ml^−1) were premixed with 50 PFU of coronavirus (SARS-CoV-2) in PBS or PB at room temperature. After 45–60 min of incubation, peptide-virus mixture was transferred to Vero-E6 cells, correspondingly. At 1 h post infection, infectious media were removed and 1% low melting agar was added to cells. Cells were fixed using 4% formalin at 3 day post infection. Crystal blue (0.1%) was added for staining, and the number of plaques was counted. |
| Anti-CoV activity in vivo: | |
| Reference: | 32843628 |
| Comment: | |
| 3D structure: | |
| Structure Experiment Verified: | YES |
| Similar Peptides: | |