General information | |
ACovPid: | ACoVP100356 |
Trivial Name: | P9R |
Amino Acids Sequence: | NGAICWGPCPTAFRQIGNCGRFRVRCCRIR |
Length: | 30 |
C-Terminal Modification: | None |
N-Terminal Modification: | None |
Chemical Modification: | None |
Peptide Source: | Mouse β-defensin-4 (mBD4) : 10090 |
Source Description: | |
Against Virus: | Severe acute respiratory syndrome coronavirus (SARS-CoV) : 694009 |
Inhibition Value Type: | IC50 |
Inhibitory Effect: | 0.9 |
Inhibitory Unit: | µg/mL |
Target Domain Name: | |
Assay: | Plaque reduction assay |
Assay Description: | Antiviral activity of peptides was measured using a plaque reduction assay. Briefly, peptides were dissolved in 30 mM phosphate buffer (PB) containing 24.6 mM Na2HPO4 and 5.6 mM KH2PO4 at a pH of 7.4. Peptides or bovine serum albumin (BSA, 0.4–50.0 µg ml^−1) were premixed with 50 PFU of coronaviruses (SARS-CoV-2, MERS-CoV, and SARS-CoV), influenza viruses (H1N1 virus and H7N9 virus), rhinovirus, or parainfluenza 3 in PB at room temperature. After 45–60 min of incubation, peptide-virus mixture was transferred to VERO-E6, MDCK, RD, or LLC-MK2 cells, correspondingly. At 1 h post infection, infectious media were removed and 1% low melting agar was added to cells. Cells were fixed using 4% formalin at 2–4 day post infection. Crystal blue (0.1%) was added for staining, and the number of plaques was counted. |
Anti-CoV activity in vivo: | |
Reference: | 32843628 |
Comment: | This assay present the effect of inhibit for SARS-CoV-2 |
3D structure: | |
Structure Experiment Verified: | YES |
Similar Peptides: |