| General information | |
| ACovPid: | ACoVP100355 |
| Trivial Name: | P9 |
| Amino Acids Sequence: | NGAICWGPCPTAFRQIGNCGHFKVRCCKIR |
| Length: | 30 |
| C-Terminal Modification: | None |
| N-Terminal Modification: | None |
| Chemical Modification: | None |
| Peptide Source: | Mouse β-defensin-4 (mBD4) : 10090 |
| Source Description: | |
| Against Virus: | Severe acute respiratory syndrome coronavirus (SARS-CoV) : 694009 |
| Inhibition Value Type: | IC50 |
| Inhibitory Effect: | 2.4 |
| Inhibitory Unit: | µg/mL |
| Target Domain Name: | |
| Assay: | Plaque reduction assay |
| Assay Description: | Antiviral activity of peptides was measured using a plaque reduction assay. Briefly, peptides were dissolved in 30 mM phosphate buffer (PB) containing 24.6 mM Na2HPO4 and 5.6 mM KH2PO4 at a pH of 7.4. Peptides or bovine serum albumin (BSA, 0.4–50.0 µg ml^−1) were premixed with 50 PFU of coronaviruses (SARS-CoV-2, MERS-CoV, and SARS-CoV), influenza viruses (H1N1 virus and H7N9 virus), rhinovirus, or parainfluenza 3 in PB at room temperature. After 45–60 min of incubation, peptide-virus mixture was transferred to VERO-E6, MDCK, RD, or LLC-MK2 cells, correspondingly. At 1 h post infection, infectious media were removed and 1% low melting agar was added to cells. Cells were fixed using 4% formalin at 2–4 day post infection. Crystal blue (0.1%) was added for staining, and the number of plaques was counted. |
| Anti-CoV activity in vivo: | |
| Reference: | 32843628 |
| Comment: | This assay present the effect of inhibit for SARS-CoV-2 |
| 3D structure: | |
| Structure Experiment Verified: | NO |
| Similar Peptides: | |