General information
    ACovPid:ACoVP100353
    Trivial Name:P9
    Amino Acids Sequence:NGAICWGPCPTAFRQIGNCGHFKVRCCKIR
    Length:30
    C-Terminal Modification:None
    N-Terminal Modification:None
    Chemical Modification:None
    Peptide Source:

    Mouse β-defensin-4 (mBD4) : 10090

    Source Description:
    Against Virus:

    Severe acute respiratory syndrome coronavirus (SARS-CoV) : 694009

    Inhibition Value Type:IC50
    Inhibitory Effect:6.2
    Inhibitory Unit:µg/mL
    Target Domain Name:
    Assay:Plaque reduction assay
    Assay Description:Antiviral activity of peptides was measured using a plaque reduction assay. Briefly, peptides were dissolved in 30 mM phosphate buffer (PB) containing 24.6 mM Na2HPO4 and 5.6 mM KH2PO4 at a pH of 7.4. Peptides or bovine serum albumin (BSA, 0.4–50.0 µg ml^−1) were premixed with 50 PFU of coronaviruses (SARS-CoV-2, MERS-CoV, and SARS-CoV), influenza viruses (H1N1 virus and H7N9 virus), rhinovirus, or parainfluenza 3 in PB at room temperature. After 45–60 min of incubation, peptide-virus mixture was transferred to VERO-E6, MDCK, RD, or LLC-MK2 cells, correspondingly. At 1 h post infection, infectious media were removed and 1% low melting agar was added to cells. Cells were fixed using 4% formalin at 2–4 day post infection. Crystal blue (0.1%) was added for staining, and the number of plaques was counted.
    Anti-CoV activity in vivo:
    Reference:32843628
    Comment:This assay present the effect of inhibit for SARS-CoV
    3D structure:

    StructureACoVP100353

    Structure Experiment Verified:NO
    Similar Peptides: