| General information | |
| ACovPid: | ACoVP100323 |
| Trivial Name: | HR2P-M2 |
| Amino Acids Sequence: | SLTQINTTLLDLEYEMKKLEEVVKKLEESYIDLKEL |
| Length: | 36 |
| C-Terminal Modification: | None |
| N-Terminal Modification: | None |
| Chemical Modification: | None |
| Peptide Source: | Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (MERS-CoV) (Betacoronavirus England 1) : 1263720 |
| Source Description: | |
| Against Virus: | |
| Inhibition Value Type: | EC50 |
| Inhibitory Effect: | 0.15 ± 0.06 |
| Inhibitory Unit: | µM |
| Target Domain Name: | HR1 domain of MERS-CoV (Betacoronavirus England 1) |
| Assay: | Cell–cell fusion assay |
| Assay Description: | The target cells were Huh-7 cells expressing the MERS-CoV receptor dipeptidyl peptidase 4. The effector cells were 293T/MERS/enhanced GFP protein (EGFP) cells. The 293T/MERS/EGPF cells contained the MERS-CoV S protein gene and the EGFP gene transfected with plasmid. The 293T/EGFP cells expressing only EGFP were employed as negative control cells. Huh-7 cells were plated in 96-well plates (5 × 10^4 cells/well) at 37 °C for 5 h. Then, serially diluted peptide samples were added, followed by the addition of 293T/MERS/EGPF cells or 293T/EGFP cells (1 × 10^4 cells/well). After coculturing at 37 °C for 4 h, the 293T/MERS/EGFP cells and 293T/EGFP cells, either fused or unfused, with Huh-7 cells were counted under an inverted fluorescence microscope (Nikon Eclipse Ti-S). |
| Anti-CoV activity in vivo: | |
| Reference: | 29442512 |
| Comment: | |
| 3D structure: | |
| Structure Experiment Verified: | NO |
| Similar Peptides: | ACoVP100139 ACoVP100070 ACoVP100141 ACoVP100178 ACoVP100116 |
| Target Domain information | |
| Target Domain Full Name: | Heptad repeat 1 (HR1) domain of Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (MERS-CoV) (Betacoronavirus England 1) spike glycoprotein |
| Target Type: | glycoprotein |
| UniprotID [Sequence]: | K9N5Q8 [994-1044] |
| Target Synonyms: | Alternative name(s) for spike glycoprotein: E2 Peplomer protein S glycoprotein |
| Target Source: | Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (MERS-CoV) (Betacoronavirus England 1) : 1263720 |
| Target Structure: | 4L72, 4MOD, 4XAK, 4ZPT, 4ZPV, 4ZPW, 5GMQ, 5GR7, 5GSB, 5GSR, 5GSV, 5GSX, 5VYH, 5W9H, 5W9I, 5W9J, 5W9K, 5W9L, 5W9M, 5W9N, 5W9O, 5W9P, 5X4R, 5X59, 5X5C, 5X5F, 5YY5, 5ZVK, 5ZXV, 6C6Y, 6C6Z, 6J11, 6J2J, 6L8Q, 6PXH, 6WAR |