General information | |
ACovPid: | ACoVP100276 |
Trivial Name: | MERS-5HB |
Amino Acids Sequence: | GITQQVLSENQKLIANKFNQALGAMQTGFTTTNEAFQKVQDAVNNNAQALSKLSAELSNTFGAISASIGDIIQRLDVLE-SGGRGG-SIPNFGSLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKELGNY-GGSGGSGG-GITQQVLSENQKLIANKFNQALGAMQTGFTTTNEAFQKVQDAVNNNAQALSKLSAELSNTFGAISASIGDIIQRLDVLE-SGGRGG-SIPNFGSLTQINTTLLDLTYEMLSLQ |
Length: | 352 |
C-Terminal Modification: | None |
N-Terminal Modification: | None |
Chemical Modification: | None |
Peptide Source: | The Middle East respiratory syndrome coronavirus (MERS-CoV) : |
Source Description: | S2 subunit of spike (S) protein of MERS-CoV |
Against Virus: | |
Inhibition Value Type: | IC50 |
Inhibitory Effect: | ~1 |
Inhibitory Unit: | µg/mL |
Target Domain Name: | HR2 domain of SARS-CoV |
Assay: | Pseudotyped virus infection inhibition assay |
Assay Description: | The assay of MERS-CoV pseudovirus entry inhibition was performed on the basis of previously described methods(PMID: 24067982, 25451066).The MERS pseudovirus was prepared by cotransfecting 293T cells with a plasmid encoding an Env-defective, luciferase-expressing HIV-1 genome (pNL4-3.luc.RE) (27) and the pCAGGS-MERS-S expression plasmid using Lipofectamine 2000 (Invitrogen). The pseudovirus-containing supernatant was harvested 48 h following transfection, clarified by centrifugation, and then filtered through a 0.45-µm sterilized membrane. Single-use aliquots (1.0 ml) were stored at −80°C. To detect the inhibitory activity of MERS-5HB, 100 TCID50 of MERS-CoV pseudovirus was pre-incubated with 3-fold serially diluted MERS-5HB in quadruplicate from the highest concentration of 15 µM at 37 °C for 1 h. The virus–protein mixture was then transferred to a 96-well white opaque plate seeded with Huh-7 cells (1 × 10^4/well). Twelve hours later, cells were re-fed with fresh medium (100 µL/well), which was followed by luminescence measurement after a 72-h incubation period. The vesicular stomatitis virus (VSV) pseudovirus was prepared as a control. The inhibition of MERS-CoV pseudovirus was presented as percent inhibition. |
Anti-CoV activity in vivo: | |
Reference: | 28906430 |
Comment: | |
3D structure: | |
Structure Experiment Verified: | |
Similar Peptides: | ACoVP100219   ACoVP100230   ACoVP100129   ACoVP100260   ACoVP100258 |
Target Domain information | |
Target Domain Full Name: | Heptad repeat 2 (HR2) domain of Severe acute respiratory syndrome coronavirus (SARS-CoV) spike glycoprotein |
Target Type: | glycoprotein |
UniprotID [Sequence]: | P59594 [1145-1184] |
Target Synonyms: | Alternative name(s) for spike glycoprotein: E2 Peplomer protein S glycoprotein |
Target Source: | Severe acute respiratory syndrome coronavirus (SARS-CoV) : 694009 |
Target Structure: | 1WNC, 1WYY, 1ZV7, 1ZV8, 1ZVB, 2AJF, 2BEQ, 2BEZ, 2DD8, 2FXP, 2GHV, 2GHW, 2RUM, 2RUN, 2RUO, 3BGF, 3D0G, 3D0H, 3D0I, 3SCI, 3SCJ, 3SCK, 3SCL, 5WRG, 5X4S, 5X58, 5X5B, 5XJK, 5XLR, 5ZVM, 6ACC, 6ACD, 6ACG, 6ACJ, 6ACK, 6CRV, 6CRW, 6CRX, 6CRZ, 6CS0, 6CS1, 6CS2, 6M3W, 6NB6, 6NB7, 6VW1, 6WAQ, 7JN5 |