General information
    ACovPid:ACoVP100276
    Trivial Name:MERS-5HB
    Amino Acids Sequence:GITQQVLSENQKLIANKFNQALGAMQTGFTTTNEAFQKVQDAVNNNAQALSKLSAELSNTFGAISASIGDIIQRLDVLE-SGGRGG-SIPNFGSLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKELGNY-GGSGGSGG-GITQQVLSENQKLIANKFNQALGAMQTGFTTTNEAFQKVQDAVNNNAQALSKLSAELSNTFGAISASIGDIIQRLDVLE-SGGRGG-SIPNFGSLTQINTTLLDLTYEMLSLQ
    Length:352
    C-Terminal Modification:None
    N-Terminal Modification:None
    Chemical Modification:None
    Peptide Source:

    The Middle East respiratory syndrome coronavirus (MERS-CoV) :

    Source Description:S2 subunit of spike (S) protein of MERS-CoV
    Against Virus:

    The Middle East respiratory syndrome coronavirus (MERS-CoV)

    Inhibition Value Type:IC50
    Inhibitory Effect:~1
    Inhibitory Unit:µg/mL
    Target Domain Name:HR2 domain of SARS-CoV
    Assay:Pseudotyped virus infection inhibition assay
    Assay Description:The assay of MERS-CoV pseudovirus entry inhibition was performed on the basis of previously described methods(PMID: 24067982, 25451066).The MERS pseudovirus was prepared by cotransfecting 293T cells with a plasmid encoding an Env-defective, luciferase-expressing HIV-1 genome (pNL4-3.luc.RE) (27) and the pCAGGS-MERS-S expression plasmid using Lipofectamine 2000 (Invitrogen). The pseudovirus-containing supernatant was harvested 48 h following transfection, clarified by centrifugation, and then filtered through a 0.45-µm sterilized membrane. Single-use aliquots (1.0 ml) were stored at −80°C. To detect the inhibitory activity of MERS-5HB, 100 TCID50 of MERS-CoV pseudovirus was pre-incubated with 3-fold serially diluted MERS-5HB in quadruplicate from the highest concentration of 15 µM at 37 °C for 1 h. The virus–protein mixture was then transferred to a 96-well white opaque plate seeded with Huh-7 cells (1 × 10^4/well). Twelve hours later, cells were re-fed with fresh medium (100 µL/well), which was followed by luminescence measurement after a 72-h incubation period. The vesicular stomatitis virus (VSV) pseudovirus was prepared as a control. The inhibition of MERS-CoV pseudovirus was presented as percent inhibition.
    Anti-CoV activity in vivo:
    Reference:28906430
    Comment:
    3D structure:

    Structure Experiment Verified:
    Similar Peptides:ACoVP100219   ACoVP100230   ACoVP100129   ACoVP100260   ACoVP100258

    Target Domain information
    Target Domain Full Name:Heptad repeat 2 (HR2) domain of Severe acute respiratory syndrome coronavirus (SARS-CoV) spike glycoprotein
    Target Type:glycoprotein
    UniprotID [Sequence]:

    P59594 [1145-1184]

    Target Synonyms:Alternative name(s) for spike glycoprotein: E2 Peplomer protein S glycoprotein
    Target Source:

    Severe acute respiratory syndrome coronavirus (SARS-CoV) : 694009

    Target Structure:1WNC, 1WYY, 1ZV7, 1ZV8, 1ZVB, 2AJF, 2BEQ, 2BEZ, 2DD8, 2FXP, 2GHV, 2GHW, 2RUM, 2RUN, 2RUO, 3BGF, 3D0G, 3D0H, 3D0I, 3SCI, 3SCJ, 3SCK, 3SCL, 5WRG, 5X4S, 5X58, 5X5B, 5XJK, 5XLR, 5ZVM, 6ACC, 6ACD, 6ACG, 6ACJ, 6ACK, 6CRV, 6CRW, 6CRX, 6CRZ, 6CS0, 6CS1, 6CS2, 6M3W, 6NB6, 6NB7, 6VW1, 6WAQ, 7JN5