| General information | |
| ACovPid: | ACoVP100274 |
| Trivial Name: | P9 |
| Amino Acids Sequence: | NGAICWGPCPTAFRQIGNCGHFKVRCCKIR |
| Length: | 30 |
| C-Terminal Modification: | None |
| N-Terminal Modification: | None |
| Chemical Modification: | None |
| Peptide Source: | Mouse β-defensin-4 (mBD4) : 10090 |
| Source Description: | Mouse β-defensin-4 (mBD4) |
| Against Virus: | Severe acute respiratory syndrome coronavirus (SARS-CoV) : 694009 |
| Inhibition Value Type: | IC50 |
| Inhibitory Effect: | ~5 |
| Inhibitory Unit: | µg/mL |
| Target Domain Name: | S2 domain of SARS-CoV |
| Assay: | |
| Assay Description: | |
| Anti-CoV activity in vivo: | |
| Reference: | 26911565 |
| Comment: | |
| 3D structure: | |
| Structure Experiment Verified: | NO |
| Similar Peptides: | |
| Target Domain information | |
| Target Domain Full Name: | S2 domain of Severe acute respiratory syndrome coronavirus (SARS-CoV) spike glycoprotein |
| Target Type: | glycoprotein |
| UniprotID [Sequence]: | P59594 [673–1255] |
| Target Synonyms: | Alternative name(s) for spike glycoprotein: E2 Peplomer protein S glycoprotein |
| Target Source: | Severe acute respiratory syndrome coronavirus (SARS-CoV) : 694009 |
| Target Structure: | 1WNC, 1WYY, 1ZV7, 1ZV8, 1ZVB, 2AJF, 2BEQ, 2BEZ, 2DD8, 2FXP, 2GHV, 2GHW, 2RUM, 2RUN, 2RUO, 3BGF, 3D0G, 3D0H, 3D0I, 3SCI, 3SCJ, 3SCK, 3SCL, 5WRG, 5X4S, 5X58, 5X5B, 5XJK, 5XLR, 5ZVM, 6ACC, 6ACD, 6ACG, 6ACJ, 6ACK, 6CRV, 6CRW, 6CRX, 6CRZ, 6CS0, 6CS1, 6CS2, 6M3W, 6NB6, 6NB7, 6VW1, 6WAQ, 7JN5 |