General information | |
ACovPid: | ACoVP100274 |
Trivial Name: | P9 |
Amino Acids Sequence: | NGAICWGPCPTAFRQIGNCGHFKVRCCKIR |
Length: | 30 |
C-Terminal Modification: | None |
N-Terminal Modification: | None |
Chemical Modification: | None |
Peptide Source: | Mouse β-defensin-4 (mBD4) : 10090 |
Source Description: | Mouse β-defensin-4 (mBD4) |
Against Virus: | Severe acute respiratory syndrome coronavirus (SARS-CoV) : 694009 |
Inhibition Value Type: | IC50 |
Inhibitory Effect: | ~5 |
Inhibitory Unit: | µg/mL |
Target Domain Name: | S2 domain of SARS-CoV |
Assay: | |
Assay Description: | |
Anti-CoV activity in vivo: | |
Reference: | 26911565 |
Comment: | |
3D structure: | |
Structure Experiment Verified: | NO |
Similar Peptides: |
Target Domain information | |
Target Domain Full Name: | S2 domain of Severe acute respiratory syndrome coronavirus (SARS-CoV) spike glycoprotein |
Target Type: | glycoprotein |
UniprotID [Sequence]: | P59594 [673–1255] |
Target Synonyms: | Alternative name(s) for spike glycoprotein: E2 Peplomer protein S glycoprotein |
Target Source: | Severe acute respiratory syndrome coronavirus (SARS-CoV) : 694009 |
Target Structure: | 1WNC, 1WYY, 1ZV7, 1ZV8, 1ZVB, 2AJF, 2BEQ, 2BEZ, 2DD8, 2FXP, 2GHV, 2GHW, 2RUM, 2RUN, 2RUO, 3BGF, 3D0G, 3D0H, 3D0I, 3SCI, 3SCJ, 3SCK, 3SCL, 5WRG, 5X4S, 5X58, 5X5B, 5XJK, 5XLR, 5ZVM, 6ACC, 6ACD, 6ACG, 6ACJ, 6ACK, 6CRV, 6CRW, 6CRX, 6CRZ, 6CS0, 6CS1, 6CS2, 6M3W, 6NB6, 6NB7, 6VW1, 6WAQ, 7JN5 |