General information
    ACovPid:ACoVP100272
    Trivial Name:GRFT
    Amino Acids Sequence:SLTHRKFGGSGGSPFSGLSSIAVRSGSYLDAIIDGVHHGSGGNLSPTFTFGSGEYISNMTIRSGDYIDNI SFETNMGRRFGPYGGSGGSANTLSNVKVIQINGSAGDYLDSLDIYYEQY
    Length:121
    C-Terminal Modification:None
    N-Terminal Modification:None
    Chemical Modification:None
    Peptide Source:

    Griffithsia sp. : 373036

    Source Description:Its activity against the human immunodeficiency virus (HIV)
    Against Virus:

    Severe acute respiratory syndrome coronavirus (SARS-CoV) : 694009

    Inhibition Value Type:IC50
    Inhibitory Effect:>10
    Inhibitory Unit:µg/mL
    Target Domain Name:
    Assay:Cytopathic effect (CPE) inhibition assay
    Assay Description:The neutral red (NR) uptake assay was done on the same CPE inhibition test plates as described above to verify the inhibitory activity and the cytotoxicity observed by visual observation. The NR assay was performed first. Briefly, medium was removed from each well of a plate, 0.011% NR was added to each well of the plate and the plate incubated for 2 h at 37°C in the dark. The NR solution was removed from the wells. Medium was removed from each well of a plate, 0.034% NRF (0.34% neutral red in phosphate-buffered saline [PBS] supplemented with formalin at 10%) was added to each well of the plate, and the plate was incubated for 2 h at 37°C in the dark. The NR solution was then removed from the wells and rinsed, and the remaining dye was extracted using ethanol buffered with Sörenson's citrate buffer. Absorbances at 540 nm/405 nm were read with a microplate reader (Opsys MR; Dynex Technologies, Chantilly, VA). Absorbance values were expressed as percentages of untreated controls and EC50, IC50, and SI values were calculated as described above.
    Anti-CoV activity in vivo:
    Reference:20032190
    Comment:HCoV (NL63) in rhesus monkey kidney cells (LLC-MK2)
    3D structure:

    StructureACoVP100272

    Structure Experiment Verified:NO
    Similar Peptides: