| General information | |
| ACovPid: | ACoVP100270 |
| Trivial Name: | GRFT |
| Amino Acids Sequence: | SLTHRKFGGSGGSPFSGLSSIAVRSGSYLDAIIDGVHHGSGGNLSPTFTFGSGEYISNMTIRSGDYIDNI SFETNMGRRFGPYGGSGGSANTLSNVKVIQINGSAGDYLDSLDIYYEQY |
| Length: | 121 |
| C-Terminal Modification: | None |
| N-Terminal Modification: | None |
| Chemical Modification: | None |
| Peptide Source: | Griffithsia sp. : 373036 |
| Source Description: | Its activity against the human immunodeficiency virus (HIV) |
| Against Virus: | Severe acute respiratory syndrome coronavirus (SARS-CoV) : 694009 |
| Inhibition Value Type: | IC50 |
| Inhibitory Effect: | >10 |
| Inhibitory Unit: | µg/mL |
| Target Domain Name: | |
| Assay: | Cytopathic effect (CPE) inhibition assay |
| Assay Description: | The neutral red (NR) uptake assay was done on the same CPE inhibition test plates as described above to verify the inhibitory activity and the cytotoxicity observed by visual observation. The NR assay was performed first. Briefly, medium was removed from each well of a plate, 0.011% NR was added to each well of the plate and the plate incubated for 2 h at 37°C in the dark. The NR solution was removed from the wells. Medium was removed from each well of a plate, 0.034% NRF (0.34% neutral red in phosphate-buffered saline [PBS] supplemented with formalin at 10%) was added to each well of the plate, and the plate was incubated for 2 h at 37°C in the dark. The NR solution was then removed from the wells and rinsed, and the remaining dye was extracted using ethanol buffered with Sörenson's citrate buffer. Absorbances at 540 nm/405 nm were read with a microplate reader (Opsys MR; Dynex Technologies, Chantilly, VA). Absorbance values were expressed as percentages of untreated controls and EC50, IC50, and SI values were calculated as described above. |
| Anti-CoV activity in vivo: | |
| Reference: | 20032190 |
| Comment: | HCoV (229E) in human diploid fibroblast cells (MRC-5) |
| 3D structure: | |
| Structure Experiment Verified: | NO |
| Similar Peptides: | |