General information
    ACovPid:ACoVP100263
    Trivial Name:GRFT
    Amino Acids Sequence:SLTHRKFGGSGGSPFSGLSSIAVRSGSYLDAIIDGVHHGSGGNLSPTFTFGSGEYISNMTIRSGDYIDNI SFETNMGRRFGPYGGSGGSANTLSNVKVIQINGSAGDYLDSLDIYYEQY
    Length:121
    C-Terminal Modification:None
    N-Terminal Modification:None
    Chemical Modification:None
    Peptide Source:

    Griffithsia sp. : 373036

    Source Description:Its activity against the human immunodeficiency virus (HIV)
    Against Virus:

    Severe acute respiratory syndrome coronavirus (SARS-CoV) : 694009

    Inhibition Value Type:EC50
    Inhibitory Effect:52
    Inhibitory Unit:µg/mL
    Target Domain Name:
    Assay:Cytopathic effect (CPE) inhibition assay
    Assay Description:Cells were seeded into 96-well flat-bottomed tissue culture plates (Corning Glass Works, Corning, NY), 0.2 ml/well, at the proper cell concentration, and incubated overnight at 37°C in order to establish a cell monolayer. When the monolayer was established, the growth medium was decanted and the various dilutions of test compound were added to each well (3 wells/dilution, 0.1 ml/well). Compound diluent medium was added to cell and virus control wells (0.1 ml/well). Virus (viral multiplicity of infection [MOI] = 0.01 to 0.001), diluted in test medium, was added to compound test wells (3 wells/dilution of compound) and to virus control wells at 0.1 ml/well. Virus was added approximately 5 min after compound. Test medium without virus was added to all toxicity control wells (2 wells/dilution of each test compound) and to cell control wells at 0.1 ml/well. The plates were incubated at 37°C or at 33°C (HCoV-OC43, HCoV-299E, and HCoV-NL63) in a humidified incubator with a 5% CO2-95% air atmosphere until virus control wells had adequate cytopathic effect (CPE) readings. This was achieved in 3 to 10 days after virus exposure to cells, depending on the virus. Cells were then examined microscopically for CPE, this being scored from 0 (normal cells) to 4 (maximal, 100% CPE). The cells in the toxicity control wells were observed microscopically for morphological changes attributed to cytotoxicity. This cytotoxicity was also graded as T (100% toxicity, complete cell sloughing from plate), PVH (80% cytotoxicity), PH (60% cytotoxicity), P (40% cytotoxicity), PSl (20% cytotoxicity), and 0 (normal cells). The 50% effective dose (EC50) and 50% cytotoxic dose (IC50) was calculated by regression analysis of the virus CPE data and the toxicity control data, respectively. The therapeutic index (SI) for each compound tested was calculated using the formula SI = IC50/EC50.
    Anti-CoV activity in vivo:
    Reference:20032190
    Comment:For HCoV (OC43) in human ileocecal colorectal human adenocarcinoma cells (HCT-8)
    3D structure:

    StructureACoVP100263

    Structure Experiment Verified:NO
    Similar Peptides: