| General information | |
| ACovPid: | ACoVP100239 |
| Trivial Name: | HR2-5 |
| Amino Acids Sequence: | FKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNES |
| Length: | 41 |
| C-Terminal Modification: | None |
| N-Terminal Modification: | None |
| Chemical Modification: | None |
| Peptide Source: | Severe acute respiratory syndrome coronavirus (SARS-CoV) : 694009 |
| Source Description: | From the heptad repeat region 2 of spike glycoprotein of SARS-CoV |
| Against Virus: | Severe acute respiratory syndrome coronavirus (SARS-CoV) : 694009 |
| Inhibition Value Type: | EC50 |
| Inhibitory Effect: | |
| Inhibitory Unit: | |
| Target Domain Name: | |
| Assay: | Pseudotyped virus infection inhibition assay |
| Assay Description: | To produce HIV-luc/SARS pseudotyped virus, 10 µg of pNL-4-3E-R-Luc (HIV-luc) and 10 µg codon optimized SARS-CoV S protein expression plasmids pcTSh were co-transfected into 2 × 106 293T cells with calcium phosphate. The medium was replaced 16 h posttransfection. After further 48 h incubation, the supernatant containing the pseudotyped virus was collected and filtered through a 0.45 µm Millipore-sized membrane. For the inhibition assay, 0.5 ng of HIV-luc/SARS pseudotyped virus was incubated with serially diluted peptides at 37 °C for 30 min. The virus/peptide mixture was then transferred to 96-well plates seeded with Vero E6 cells (3 × 103 cells/well). Each concentration was tested in octuple. After overnight incubation, the medium was replaced and the sample was incubated for an additional 36 h. The cells were then lysed and luciferase activities were measured by a Wallac Mutilabel 1420 Counter (Perkin–Elmer) using the Luciferase Assay System (Promega). |
| Anti-CoV activity in vivo: | |
| Reference: | 15184046 |
| Comment: | |
| 3D structure: | |
| Structure Experiment Verified: | NO |
| Similar Peptides: | ACoVP100125 ACoVP100126 ACoVP100118 ACoVP100120 ACoVP100121 |