| General information | |
| ACovPid: | ACoVP100218 |
| Trivial Name: | CP-2 |
| Amino Acids Sequence: | KEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYVW |
| Length: | 37 |
| C-Terminal Modification: | None |
| N-Terminal Modification: | None |
| Chemical Modification: | None |
| Peptide Source: | Severe acute respiratory syndrome coronavirus (SARS-CoV) : 694009 |
| Source Description: | From the heptad repeat 2 region of spike glycoprotein of SARS-CoV |
| Against Virus: | Severe acute respiratory syndrome coronavirus (SARS-CoV) : 694009 |
| Inhibition Value Type: | IC50 |
| Inhibitory Effect: | 19 |
| Inhibitory Unit: | µM |
| Target Domain Name: | HR1 domain of SARS-CoV |
| Assay: | Cytopathic effect (CPE) inhibition assay |
| Assay Description: | The inhibitory activity of the synthetic peptides on SARS-CoV infection of Vero E6 cells was performed.was assessed as previously described(PMID: 32214698). 100 TCID50 (50% tissue-culture infectious dose) of SARS-CoV WHU strain (accession number AY394850) was mixed with an equal volume of a peptide at graded concentrations and incubated at 37°C for 30 min. The mixture was added to monolayers of Vero E6 cells in 96-well tissue-culture plates. After incubation at 37°C for 1 h, the supernatants were removed and fresh medium was added. On day 3 after infection, the cytopathic effect was recorded and the concentrations of the peptides resulting in 50% inhibition (IC50) were calculated. |
| Anti-CoV activity in vivo: | |
| Reference: | 15043961 |
| Comment: | |
| 3D structure: | |
| Structure Experiment Verified: | NO |
| Similar Peptides: | ACoVP100242   ACoVP100246   ACoVP100250   ACoVP100252   ACoVP100253 |
| Target Domain information | |
| Target Domain Full Name: | Heptad repeat 1 (HR1) domain of Severe acute respiratory syndrome coronavirus (SARS-CoV) spike glycoprotein |
| Target Type: | glycoprotein |
| UniprotID [Sequence]: | P59594 [902-952] |
| Target Synonyms: | Alternative name(s) for spike glycoprotein: E2 Peplomer protein S glycoprotein |
| Target Source: | Severe acute respiratory syndrome coronavirus (SARS-CoV) : 694009 |
| Target Structure: | 1WNC, 1WYY, 1ZV7, 1ZV8, 1ZVB, 2AJF, 2BEQ, 2BEZ, 2DD8, 2FXP, 2GHV, 2GHW, 2RUM, 2RUN, 2RUO, 3BGF, 3D0G, 3D0H, 3D0I, 3SCI, 3SCJ, 3SCK, 3SCL, 5WRG, 5X4S, 5X58, 5X5B, 5XJK, 5XLR, 5ZVM, 6ACC, 6ACD, 6ACG, 6ACJ, 6ACK, 6CRV, 6CRW, 6CRX, 6CRZ, 6CS0, 6CS1, 6CS2, 6M3W, 6NB6, 6NB7, 6VW1, 6WAQ, 7JN5 |