General information
    ACovPid:ACoVP100218
    Trivial Name:CP-2
    Amino Acids Sequence:KEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYVW
    Length:37
    C-Terminal Modification:None
    N-Terminal Modification:None
    Chemical Modification:None
    Peptide Source:

    Severe acute respiratory syndrome coronavirus (SARS-CoV) : 694009

    Source Description:From the heptad repeat 2 region of spike glycoprotein of SARS-CoV
    Against Virus:

    Severe acute respiratory syndrome coronavirus (SARS-CoV) : 694009

    Inhibition Value Type:IC50
    Inhibitory Effect:19
    Inhibitory Unit:µM
    Target Domain Name:HR1 domain of SARS-CoV
    Assay:Cytopathic effect (CPE) inhibition assay
    Assay Description:The inhibitory activity of the synthetic peptides on SARS-CoV infection of Vero E6 cells was performed.was assessed as previously described(PMID: 32214698). 100 TCID50 (50% tissue-culture infectious dose) of SARS-CoV WHU strain (accession number AY394850) was mixed with an equal volume of a peptide at graded concentrations and incubated at 37°C for 30 min. The mixture was added to monolayers of Vero E6 cells in 96-well tissue-culture plates. After incubation at 37°C for 1 h, the supernatants were removed and fresh medium was added. On day 3 after infection, the cytopathic effect was recorded and the concentrations of the peptides resulting in 50% inhibition (IC50) were calculated.
    Anti-CoV activity in vivo:
    Reference:15043961
    Comment:
    3D structure:

    StructureACoVP100218

    Structure Experiment Verified:NO
    Similar Peptides:ACoVP100242   ACoVP100246   ACoVP100250   ACoVP100252   ACoVP100253

    Target Domain information
    Target Domain Full Name:Heptad repeat 1 (HR1) domain of Severe acute respiratory syndrome coronavirus (SARS-CoV) spike glycoprotein
    Target Type:glycoprotein
    UniprotID [Sequence]:

    P59594 [902-952]

    Target Synonyms:Alternative name(s) for spike glycoprotein: E2 Peplomer protein S glycoprotein
    Target Source:

    Severe acute respiratory syndrome coronavirus (SARS-CoV) : 694009

    Target Structure:1WNC, 1WYY, 1ZV7, 1ZV8, 1ZVB, 2AJF, 2BEQ, 2BEZ, 2DD8, 2FXP, 2GHV, 2GHW, 2RUM, 2RUN, 2RUO, 3BGF, 3D0G, 3D0H, 3D0I, 3SCI, 3SCJ, 3SCK, 3SCL, 5WRG, 5X4S, 5X58, 5X5B, 5XJK, 5XLR, 5ZVM, 6ACC, 6ACD, 6ACG, 6ACJ, 6ACK, 6CRV, 6CRW, 6CRX, 6CRZ, 6CS0, 6CS1, 6CS2, 6M3W, 6NB6, 6NB7, 6VW1, 6WAQ, 7JN5