General information | |
ACovPid: | ACoVP100133 |
Trivial Name: | mHR2 |
Amino Acids Sequence: | DLSLDFEKLNVTLLDLTYEMNRIQDAIKKLNESYINLKE |
Length: | 39 |
C-Terminal Modification: | None |
N-Terminal Modification: | None |
Chemical Modification: | None |
Peptide Source: | Murine coronavirus (strain A59) (MHV-A59) (Murine hepatitis virus) : 11142 |
Source Description: | |
Against Virus: | Murine coronavirus (strain A59) (MHV-A59) (Murine hepatitis virus) : 11142 |
Inhibition Value Type: | EC50 |
Inhibitory Effect: | 0.9 ± 0.1 |
Inhibitory Unit: | µM |
Target Domain Name: | HR1 domain of MHV-A59 |
Assay: | Immune peroxidase staining assay |
Assay Description: | Inhibition of MHV by HR peptides was performed on LR7 cells in 96-well plates (e4 cells per well). Cells were inoculated in triplicate with 100 TCID50 of SARS-CoV in the presence of various peptide concentrations, ranging from 0.4 to 50 µM, for 1 h at 37°C in a CO2 incubator. Cells were then washed twice with IMDM, and the medium was replaced with IMDM containing 5% FBS. After incubation for 9 h, plates were washed twice with PBS and fixed by 4% formaldehyde for 15 min and 70% ethanol plus 0.5% H2O2 for 15 min at room temperature. Immunoperoxidase (IPOX) detection of MHV-positive cells was carried out by using a rabbit polyclonal antibody against MHV (1:300) in combination with a HRP swine-anti rabbit antibody (1:300) (Dako). Experiments were performed in triplicate and carried out in duplo. Infected cells were counted by using the light microscope, and the effective peptide concentration at which 50% of the infection was inhibited (EC50) was calculated by fitting the HR peptide inhibition data to a Langmuir function [normalized number of infected cells = 1/1(1 + [HR peptide]/IC50)]. |
Anti-CoV activity in vivo: | |
Reference: | 15150417 |
Comment: | |
3D structure: | |
Structure Experiment Verified: | NO |
Similar Peptides: | ACoVP100015   ACoVP100014   ACoVP100013   ACoVP100001   ACoVP100011 |
Target Domain information | |
Target Domain Full Name: | Heptad repeat 1 (HR1) domain of Murine coronavirus (strain A59) (MHV-A59) (Murine hepatitis virus) spike glycoprotein |
Target Type: | glycoprotein |
UniprotID [Sequence]: | P11224 [970-1020 |
Target Synonyms: | Alternative name(s) for spike glycoprotein: E2 Peplomer protein S glycoprotein |
Target Source: | Murine coronavirus (strain A59) (MHV-A59) (Murine hepatitis virus) : 11142 |
Target Structure: | 1WDF, 1WDG, 3JCL, 6B3O, 6VSJ |