General information
    ACovPid:ACoVP100133
    Trivial Name:mHR2
    Amino Acids Sequence:DLSLDFEKLNVTLLDLTYEMNRIQDAIKKLNESYINLKE
    Length:39
    C-Terminal Modification:None
    N-Terminal Modification:None
    Chemical Modification:None
    Peptide Source:

    Murine coronavirus (strain A59) (MHV-A59) (Murine hepatitis virus) : 11142

    Source Description:
    Against Virus:

    Murine coronavirus (strain A59) (MHV-A59) (Murine hepatitis virus) : 11142

    Inhibition Value Type:EC50
    Inhibitory Effect:0.9 ± 0.1
    Inhibitory Unit:µM
    Target Domain Name:HR1 domain of MHV-A59
    Assay:Immune peroxidase staining assay
    Assay Description:Inhibition of MHV by HR peptides was performed on LR7 cells in 96-well plates (e4 cells per well). Cells were inoculated in triplicate with 100 TCID50 of SARS-CoV in the presence of various peptide concentrations, ranging from 0.4 to 50 µM, for 1 h at 37°C in a CO2 incubator. Cells were then washed twice with IMDM, and the medium was replaced with IMDM containing 5% FBS. After incubation for 9 h, plates were washed twice with PBS and fixed by 4% formaldehyde for 15 min and 70% ethanol plus 0.5% H2O2 for 15 min at room temperature. Immunoperoxidase (IPOX) detection of MHV-positive cells was carried out by using a rabbit polyclonal antibody against MHV (1:300) in combination with a HRP swine-anti rabbit antibody (1:300) (Dako). Experiments were performed in triplicate and carried out in duplo. Infected cells were counted by using the light microscope, and the effective peptide concentration at which 50% of the infection was inhibited (EC50) was calculated by fitting the HR peptide inhibition data to a Langmuir function [normalized number of infected cells = 1/1(1 + [HR peptide]/IC50)].
    Anti-CoV activity in vivo:
    Reference:15150417
    Comment:
    3D structure:

    StructureACoVP100133

    Structure Experiment Verified:NO
    Similar Peptides:ACoVP100015   ACoVP100014   ACoVP100013   ACoVP100001   ACoVP100011

    Target Domain information
    Target Domain Full Name:Heptad repeat 1 (HR1) domain of Murine coronavirus (strain A59) (MHV-A59) (Murine hepatitis virus) spike glycoprotein
    Target Type:glycoprotein
    UniprotID [Sequence]:

    P11224 [970-1020

    Target Synonyms:Alternative name(s) for spike glycoprotein: E2 Peplomer protein S glycoprotein
    Target Source:

    Murine coronavirus (strain A59) (MHV-A59) (Murine hepatitis virus) : 11142

    Target Structure:1WDF, 1WDG, 3JCL, 6B3O, 6VSJ