| General information | |
| ACovPid: | ACoVP100132 |
| Trivial Name: | sHR2-1 |
| Amino Acids Sequence: | ELDSPKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYE |
| Length: | 64 |
| C-Terminal Modification: | None |
| N-Terminal Modification: | None |
| Chemical Modification: | None |
| Peptide Source: | Murine coronavirus (strain A59) (MHV-A59) (Murine hepatitis virus) : 11142 |
| Source Description: | |
| Against Virus: | Murine coronavirus (strain A59) (MHV-A59) (Murine hepatitis virus) : 11142 |
| Inhibition Value Type: | EC50 |
| Inhibitory Effect: | >50 |
| Inhibitory Unit: | µM |
| Target Domain Name: | HR1 domain of MHV-A59 |
| Assay: | Immune peroxidase staining assay |
| Assay Description: | Inhibition of MHV by HR peptides was performed on LR7 cells in 96-well plates (e4 cells per well). Cells were inoculated in triplicate with 100 TCID50 of SARS-CoV in the presence of various peptide concentrations, ranging from 0.4 to 50 µM, for 1 h at 37°C in a CO2 incubator. Cells were then washed twice with IMDM, and the medium was replaced with IMDM containing 5% FBS. After incubation for 9 h, plates were washed twice with PBS and fixed by 4% formaldehyde for 15 min and 70% ethanol plus 0.5% H2O2 for 15 min at room temperature. Immunoperoxidase (IPOX) detection of MHV-positive cells was carried out by using a rabbit polyclonal antibody against MHV (1:300) in combination with a HRP swine-anti rabbit antibody (1:300) (Dako). Experiments were performed in triplicate and carried out in duplo. Infected cells were counted by using the light microscope, and the effective peptide concentration at which 50% of the infection was inhibited (EC50) was calculated by fitting the HR peptide inhibition data to a Langmuir function [normalized number of infected cells = 1/1(1 + [HR peptide]/IC50)]. |
| Anti-CoV activity in vivo: | |
| Reference: | 15150417 |
| Comment: | |
| 3D structure: | |
| Structure Experiment Verified: | NO |
| Similar Peptides: | ACoVP100127 ACoVP100126 ACoVP100125 ACoVP100236 ACoVP100119 |
| Target Domain information | |
| Target Domain Full Name: | Heptad repeat 1 (HR1) domain of Murine coronavirus (strain A59) (MHV-A59) (Murine hepatitis virus) spike glycoprotein |
| Target Type: | glycoprotein |
| UniprotID [Sequence]: | P11224 [970-1020 |
| Target Synonyms: | Alternative name(s) for spike glycoprotein: E2 Peplomer protein S glycoprotein |
| Target Source: | Murine coronavirus (strain A59) (MHV-A59) (Murine hepatitis virus) : 11142 |
| Target Structure: | 1WDF, 1WDG, 3JCL, 6B3O, 6VSJ |