General information
    ACovPid:ACoVP100095
    Trivial Name:EK0-1
    Amino Acids Sequence:SLDYINVTFLDLQDEMKKLEEAIKKLEQSYINLKDI
    Length:36
    C-Terminal Modification:None
    N-Terminal Modification:None
    Chemical Modification:None
    Peptide Source:

    Human coronavirus OC43 (HCoV-OC43) : 31631

    Source Description:Peptide OC43-HR2P was derived from the HR2 domain of HCoV-OC43. EK0-1 was the optimized form of OC43-HR2P.
    Against Virus:

    Human coronavirus NL63 (HCoV-NL63) : 277944

    Inhibition Value Type:IC50
    Inhibitory Effect:0.78 ± 0.10
    Inhibitory Unit:µM
    Target Domain Name:HR1 domain of HCoV-NL63
    Assay:Cell-cell fusion
    Assay Description:The inhibitory activity of a test peptide on HCoV S-mediated cell-cell fusion was determined. Briefly, effector cells (293 T/S/GFP) and target cells (Huh-7 cells) were cocultured in the presence or absence of a test peptide at the indicated concentrations for fusion. After counting the fused and unfused cells, the percentage of cell-cell fusion was calculated, as described above. The percent inhibition of cell-cell fusion was calculated using the following formula as described : [1 − (E − N)/(P − N)] × 100%. “E” represents the percentage of cell-cell fusion in the experimental group. “P” represents the percentage of cell-cell fusion in the positive control group, where 293 T/HCoV S/EGFP cells were used as effector cells, to which only PBS was added. “N” is the percentage of cell-cell fusion in negative control group, where 293 T/EGFP cells were used as effector cells. The IC50 was calculated using the CalcuSyn software provided by T. C. Chou. Samples were tested in triplicate, and all those experiments were repeated twice.
    Anti-CoV activity in vivo:
    Reference:30989115
    Comment:
    3D structure:

    StructureACoVP100095

    Structure Experiment Verified:NO
    Similar Peptides:ACoVP100097   ACoVP100077   ACoVP100102   ACoVP100015   ACoVP100014

    Target Domain information
    Target Domain Full Name:Heptad repeat 1 (HR1) domain of Human coronavirus NL63 (HCoV-NL63) spike glycoprotein
    Target Type:glycoprotein
    UniprotID [Sequence]:

    Q6Q1S2 [948-1067]

    Target Synonyms:Alternative name(s) for spike glycoprotein: E2 Peplomer protein S glycoprotein
    Target Source:

    Human coronavirus NL63 (HCoV-NL63) : 277944

    Target Structure:2IEQ, 3KBH, 5SZS, 7KIP