| General information | |
| ACovPid: | ACoVP100076 |
| Trivial Name: | EK1 |
| Amino Acids Sequence: | SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKEL |
| Length: | 36 |
| C-Terminal Modification: | None |
| N-Terminal Modification: | None |
| Chemical Modification: | None |
| Peptide Source: | Human coronavirus OC43 (HCoV-OC43) : 31631 |
| Source Description: | Peptide OC43-HR2P was derived from the HR2 domain of HCoV-OC43. EK1 was the optimized form of OC43-HR2P. |
| Against Virus: | Severe acute respiratory syndrome-like coronavirus WIV1 (SL-CoV-WIV1) : 1415852 |
| Inhibition Value Type: | IC50 |
| Inhibitory Effect: | 2.1 |
| Inhibitory Unit: | µM |
| Target Domain Name: | |
| Assay: | Pseudotyped virus infection inhibition assay |
| Assay Description: | A pseudovirus bearing CoV S protein or VSV-G protein and a defective HIV-1 genome that expresses luciferase as reporter was produced in 293 T cells, and its titer was quantitated by using HIV-1 p24 ELISA. The pseudovirus was then used to infect target Huh-7 cells (or ACE2/293 T cells for pseudotyped SARS-CoV) (10^4 per well in 96-well plates) in the presence or absence of the test peptide at the indicated concentration. Twelve hours after infection, culture medium was refreshed and then incubated for an additional 48 hours, followed by washing cells with PBS, lysing cells with lysis reagent (Promega), and transferring the cell lysates to 96-well Costar flat-bottom luminometer plates (Corning Costar) for the detection of relative light units using the Firefly Luciferase Assay Kit (Promega) and an Ultra 384 luminometer (Tecan). |
| Anti-CoV activity in vivo: | |
| Reference: | 30989115 |
| Comment: | |
| 3D structure: | |
| Structure Experiment Verified: | NO |
| Similar Peptides: | ACoVP100015 ACoVP100014 ACoVP100013 ACoVP100001 ACoVP100011 |