General information
    ACovPid:ACoVP100071
    Trivial Name:EK1
    Amino Acids Sequence:SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKEL
    Length:36
    C-Terminal Modification:None
    N-Terminal Modification:None
    Chemical Modification:None
    Peptide Source:

    Human coronavirus OC43 (HCoV-OC43) : 31631

    Source Description:Peptide OC43-HR2P was derived from the HR2 domain of HCoV-OC43. EK1 was the optimized form of OC43-HR2P.
    Against Virus:

    Severe acute respiratory syndrome coronavirus (SARS-CoV) : 694009

    Inhibition Value Type:IC50
    Inhibitory Effect:2.23
    Inhibitory Unit:µM
    Target Domain Name:HR1 domain of SARS-CoV
    Assay:Pseudotyped virus infection inhibition assay
    Assay Description:A pseudovirus bearing CoV S protein or VSV-G protein and a defective HIV-1 genome that expresses luciferase as reporter was produced in 293 T cells, and its titer was quantitated by using HIV-1 p24 ELISA. The pseudovirus was then used to infect target Huh-7 cells (or ACE2/293 T cells for pseudotyped SARS-CoV) (10^4 per well in 96-well plates) in the presence or absence of the test peptide at the indicated concentration. Twelve hours after infection, culture medium was refreshed and then incubated for an additional 48 hours, followed by washing cells with PBS, lysing cells with lysis reagent (Promega), and transferring the cell lysates to 96-well Costar flat-bottom luminometer plates (Corning Costar) for the detection of relative light units using the Firefly Luciferase Assay Kit (Promega) and an Ultra 384 luminometer (Tecan).
    Anti-CoV activity in vivo:
    Reference:30989115
    Comment:
    3D structure:

    StructureACoVP100071

    Structure Experiment Verified:NO
    Similar Peptides:ACoVP100015   ACoVP100014   ACoVP100013   ACoVP100001   ACoVP100011

    Target Domain information
    Target Domain Full Name:Heptad repeat 1 (HR1) domain of Severe acute respiratory syndrome coronavirus (SARS-CoV) spike glycoprotein
    Target Type:glycoprotein
    UniprotID [Sequence]:

    P59594 [902-952]

    Target Synonyms:Alternative name(s) for spike glycoprotein: E2 Peplomer protein S glycoprotein
    Target Source:

    Severe acute respiratory syndrome coronavirus (SARS-CoV) : 694009

    Target Structure:1WNC, 1WYY, 1ZV7, 1ZV8, 1ZVB, 2AJF, 2BEQ, 2BEZ, 2DD8, 2FXP, 2GHV, 2GHW, 2RUM, 2RUN, 2RUO, 3BGF, 3D0G, 3D0H, 3D0I, 3SCI, 3SCJ, 3SCK, 3SCL, 5WRG, 5X4S, 5X58, 5X5B, 5XJK, 5XLR, 5ZVM, 6ACC, 6ACD, 6ACG, 6ACJ, 6ACK, 6CRV, 6CRW, 6CRX, 6CRZ, 6CS0, 6CS1, 6CS2, 6M3W, 6NB6, 6NB7, 6VW1, 6WAQ, 7JN5