| General information | |
| ACovPid: | ACoVP100068 |
| Trivial Name: | EK1 |
| Amino Acids Sequence: | SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKEL |
| Length: | 36 |
| C-Terminal Modification: | None |
| N-Terminal Modification: | None |
| Chemical Modification: | None |
| Peptide Source: | Human coronavirus OC43 (HCoV-OC43) : 31631 |
| Source Description: | Peptide OC43-HR2P was derived from the HR2 domain of HCoV-OC43. EK1 was the optimized form of OC43-HR2P. |
| Against Virus: | Human coronavirus NL63 (HCoV-NL63) : 277944 |
| Inhibition Value Type: | IC50 |
| Inhibitory Effect: | 0.48 |
| Inhibitory Unit: | µM |
| Target Domain Name: | HR1 domain of HCoV-NL63 |
| Assay: | Cytopathic effect assay |
| Assay Description: | The inhibitory activity of the tested peptide against NL63 replication in LLC-MK2 cells was evaluated. Briefly, 100 TCID50 of NL63 was mixed with a test peptide at graded concentration and incubated at 37°C for 30 min. The mixture was then applied in triplicate onto the monolayer of LLC-MK2 cells grown in a 96-well microtiter plate. On day 5 after infection, viral titer in the culture medium was tested, and TCID50 was calculated on the basis of the cytopathic effect (CPE). |
| Anti-CoV activity in vivo: | |
| Reference: | 30989115 |
| Comment: | We found that peptide OC43-HR2P, derived from the HR2 domain of HCoV-OC43, exhibited broad fusion inhibitory activity against multiple HCoVs. EK1, the optimized form of OC43-HR2P, showed substantially improved pan-CoV fusion inhibitory activity and pharmaceutical properties. Crystal structures indicated that EK1 can form a stable six-helix bundle structure with both short-HCoV and long-HCoV HR1s, further supporting the role of HR1 region as a viable pan-CoV target site. |
| 3D structure: | |
| Structure Experiment Verified: | NO |
| Similar Peptides: | ACoVP100015   ACoVP100014   ACoVP100013   ACoVP100001   ACoVP100011 |
| Target Domain information | |
| Target Domain Full Name: | Heptad repeat 1 (HR1) domain of Human coronavirus NL63 (HCoV-NL63) spike glycoprotein |
| Target Type: | glycoprotein |
| UniprotID [Sequence]: | Q6Q1S2 [948-1067] |
| Target Synonyms: | Alternative name(s) for spike glycoprotein: E2 Peplomer protein S glycoprotein |
| Target Source: | Human coronavirus NL63 (HCoV-NL63) : 277944 |
| Target Structure: | 2IEQ, 3KBH, 5SZS, 7KIP |