General information
    ACovPid:ACoVP100068
    Trivial Name:EK1
    Amino Acids Sequence:SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKEL
    Length:36
    C-Terminal Modification:None
    N-Terminal Modification:None
    Chemical Modification:None
    Peptide Source:

    Human coronavirus OC43 (HCoV-OC43) : 31631

    Source Description:Peptide OC43-HR2P was derived from the HR2 domain of HCoV-OC43. EK1 was the optimized form of OC43-HR2P.
    Against Virus:

    Human coronavirus NL63 (HCoV-NL63) : 277944

    Inhibition Value Type:IC50
    Inhibitory Effect:0.48
    Inhibitory Unit:µM
    Target Domain Name:HR1 domain of HCoV-NL63
    Assay:Cytopathic effect assay
    Assay Description:The inhibitory activity of the tested peptide against NL63 replication in LLC-MK2 cells was evaluated. Briefly, 100 TCID50 of NL63 was mixed with a test peptide at graded concentration and incubated at 37°C for 30 min. The mixture was then applied in triplicate onto the monolayer of LLC-MK2 cells grown in a 96-well microtiter plate. On day 5 after infection, viral titer in the culture medium was tested, and TCID50 was calculated on the basis of the cytopathic effect (CPE).
    Anti-CoV activity in vivo:
    Reference:30989115
    Comment:We found that peptide OC43-HR2P, derived from the HR2 domain of HCoV-OC43, exhibited broad fusion inhibitory activity against multiple HCoVs. EK1, the optimized form of OC43-HR2P, showed substantially improved pan-CoV fusion inhibitory activity and pharmaceutical properties. Crystal structures indicated that EK1 can form a stable six-helix bundle structure with both short-HCoV and long-HCoV HR1s, further supporting the role of HR1 region as a viable pan-CoV target site.
    3D structure:

    StructureACoVP100068

    Structure Experiment Verified:NO
    Similar Peptides:ACoVP100015   ACoVP100014   ACoVP100013   ACoVP100001   ACoVP100011

    Target Domain information
    Target Domain Full Name:Heptad repeat 1 (HR1) domain of Human coronavirus NL63 (HCoV-NL63) spike glycoprotein
    Target Type:glycoprotein
    UniprotID [Sequence]:

    Q6Q1S2 [948-1067]

    Target Synonyms:Alternative name(s) for spike glycoprotein: E2 Peplomer protein S glycoprotein
    Target Source:

    Human coronavirus NL63 (HCoV-NL63) : 277944

    Target Structure:2IEQ, 3KBH, 5SZS, 7KIP