General information | |
ACovPid: | ACoVP100067 |
Trivial Name: | EK1 |
Amino Acids Sequence: | SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKEL |
Length: | 36 |
C-Terminal Modification: | None |
N-Terminal Modification: | None |
Chemical Modification: | None |
Peptide Source: | Human coronavirus OC43 (HCoV-OC43) : 31631 |
Source Description: | Peptide OC43-HR2P was derived from the HR2 domain of HCoV-OC43. EK1 was the optimized form of OC43-HR2P. |
Against Virus: | Human coronavirus 229E (HCoV-229E) : 11137 |
Inhibition Value Type: | IC50 |
Inhibitory Effect: | 0.69 |
Inhibitory Unit: | µM |
Target Domain Name: | HR1 domain of HCoV-229E |
Assay: | Cytopathic effect assay |
Assay Description: | The inhibitory activity of the tested peptide against 229E replication in A549 cells was evaluated. Briefly, 100 TCID50 of 229E was mixed with a test peptide at graded concentration and incubated at 37°C for 30 min. The mixture was then applied in triplicate onto the monolayer of A549 cells grown in a 96-well microtiter plate. On day 5 after infection, viral titer in the culture medium was tested, and TCID50 was calculated on the basis of the cytopathic effect (CPE). |
Anti-CoV activity in vivo: | |
Reference: | 30989115 |
Comment: | We found that peptide OC43-HR2P, derived from the HR2 domain of HCoV-OC43, exhibited broad fusion inhibitory activity against multiple HCoVs. EK1, the optimized form of OC43-HR2P, showed substantially improved pan-CoV fusion inhibitory activity and pharmaceutical properties. Crystal structures indicated that EK1 can form a stable six-helix bundle structure with both short-HCoV and long-HCoV HR1s, further supporting the role of HR1 region as a viable pan-CoV target site. |
3D structure: | |
Structure Experiment Verified: | NO |
Similar Peptides: | ACoVP100015   ACoVP100014   ACoVP100013   ACoVP100001   ACoVP100011 |
Target Domain information | |
Target Domain Full Name: | Heptad repeat 1 (HR1) domain of Human coronavirus 229E (HCoV-229E) spike glycoprotein |
Target Type: | glycoprotein |
UniprotID [Sequence]: | P15423 [767-886] |
Target Synonyms: | Alternative name(s) for spike glycoprotein: E2 Peplomer protein S glycoprotein |
Target Source: | Human coronavirus 229E (HCoV-229E) : 11137 |
Target Structure: | 5YL9, 5ZHY, 5ZUV, 6ATK, 6U7H, 7CYC, 7CYD |