General information
    ACovPid:ACoVP100064
    Trivial Name:EK1
    Amino Acids Sequence:SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKEL
    Length:36
    C-Terminal Modification:None
    N-Terminal Modification:None
    Chemical Modification:None
    Peptide Source:

    Human coronavirus OC43 (HCoV-OC43) : 31631

    Source Description:Peptide OC43-HR2P was derived from the HR2 domain of HCoV-OC43. EK1 was the optimized form of OC43-HR2P,and EK1C4 was the optimized form of EK1.
    Against Virus:

    Human coronavirus NL63 (HCoV-NL63) : 277944

    Inhibition Value Type:IC50
    Inhibitory Effect:3.693
    Inhibitory Unit:µM
    Target Domain Name:HR1 domain of HCoV-NL63
    Assay:Inhibition of live HCoV replication
    Assay Description:The inhibition assay for live SARS-CoV-2 and MERS-CoV was performed in a biosafety level 3 (BSL3) facility at the Wuhan Research Institute and Beijing Key Laboratory for Animal Models of Emerging and Re-emerging Infectious Diseases, respectively.6 Inhibition activity of peptides on SARS-CoV-2 and MERS-CoV was determined by plaque reduction assay. Peptides with different dilution concentrations were mixed with SARS-CoV-2 (100 TCID50) for 30 min and then added to monolayer VERO-E6 cells. After adsorption at 37 °C, the supernatant was removed, and 0.9% methyl cellulose was overlaid on the cells. After 72 h, the plates were fixed and stained. Plaques were counted by fixing with 4% paraformaldehyde and staining with 0.1% crystal violet. To test the effect of peptide on HCoV-OC43, HCoV-229E and HCoV-NL63 replication, 50 µL of 100 TCID50 virus were mixed with an equal volume of peptide and incubated at 37 °C for 1 h. Afterwards, the mixture was added to RD, Huh-7 and LLC-MK2 cells, respectively. Cell Counting Kit-8 (CCK8, Dojindo, Kumamoto, Kyushu, Japan) assay was applied to determine cytopathic effect.
    Anti-CoV activity in vivo:
    Reference:32231345
    Comment:
    3D structure:

    StructureACoVP100064

    Structure Experiment Verified:NO
    Similar Peptides:ACoVP100015   ACoVP100014   ACoVP100013   ACoVP100001   ACoVP100011

    Target Domain information
    Target Domain Full Name:Heptad repeat 1 (HR1) domain of Human coronavirus NL63 (HCoV-NL63) spike glycoprotein
    Target Type:glycoprotein
    UniprotID [Sequence]:

    Q6Q1S2 [948-1067]

    Target Synonyms:Alternative name(s) for spike glycoprotein: E2 Peplomer protein S glycoprotein
    Target Source:

    Human coronavirus NL63 (HCoV-NL63) : 277944

    Target Structure:2IEQ, 3KBH, 5SZS, 7KIP