General information | |
ACovPid: | ACoVP100057 |
Trivial Name: | EK1C4 |
Amino Acids Sequence: | SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGSG-PEG4-Chol |
Length: | 41 |
C-Terminal Modification: | Chol: cholesterol;   |
N-Terminal Modification: | None |
Chemical Modification: | PEG4: polyethylene glycol 4-based spacer;   |
Peptide Source: | Human coronavirus OC43 (HCoV-OC43) : 31631 |
Source Description: | Peptide OC43-HR2P was derived from the HR2 domain of HCoV-OC43. EK1 was the optimized form of OC43-HR2P,and EK1C4 was the optimized form of EK1. |
Against Virus: | |
Inhibition Value Type: | IC50 |
Inhibitory Effect: | 0.0042 |
Inhibitory Unit: | µM |
Target Domain Name: | |
Assay: | Inhibition of live HCoV replication |
Assay Description: | The inhibition assay for live SARS-CoV-2 and MERS-CoV was performed in a biosafety level 3 (BSL3) facility at the Wuhan Research Institute and Beijing Key Laboratory for Animal Models of Emerging and Re-emerging Infectious Diseases, respectively.6 Inhibition activity of peptides on SARS-CoV-2 and MERS-CoV was determined by plaque reduction assay. Peptides with different dilution concentrations were mixed with SARS-CoV-2 (100 TCID50) for 30 min and then added to monolayer VERO-E6 cells. After adsorption at 37 °C, the supernatant was removed, and 0.9% methyl cellulose was overlaid on the cells. After 72 h, the plates were fixed and stained. Plaques were counted by fixing with 4% paraformaldehyde and staining with 0.1% crystal violet. To test the effect of peptide on HCoV-OC43, HCoV-229E and HCoV-NL63 replication, 50 µL of 100 TCID50 virus were mixed with an equal volume of peptide and incubated at 37 °C for 1 h. Afterwards, the mixture was added to RD, Huh-7 and LLC-MK2 cells, respectively. Cell Counting Kit-8 (CCK8, Dojindo, Kumamoto, Kyushu, Japan) assay was applied to determine cytopathic effect. |
Anti-CoV activity in vivo: | |
Reference: | 32231345 |
Comment: | |
3D structure: | |
Structure Experiment Verified: | |
Similar Peptides: | ACoVP100011   ACoVP100010   ACoVP100009   ACoVP100008   ACoVP100007 |