General information
    ACovPid:ACoVP100054
    Trivial Name:EK1
    Amino Acids Sequence:SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKEL
    Length:36
    C-Terminal Modification:None
    N-Terminal Modification:None
    Chemical Modification:None
    Peptide Source:

    Human coronavirus OC43 (HCoV-OC43) : 31631

    Source Description:Peptide OC43-HR2P was derived from the HR2 domain of HCoV-OC43. EK1 was the optimized form of OC43-HR2P,and EK1C4 was the optimized form of EK1.
    Against Virus:

    Severe acute respiratory syndrome-like coronavirus Rs3367 (SL-CoV-Rs3367) : 1415834

    Inhibition Value Type:IC50
    Inhibitory Effect:6.014
    Inhibitory Unit:µM
    Target Domain Name:
    Assay:Pseudotyped virus infection inhibition assay
    Assay Description:293T cells were cotransfected with pNL4–3.luc.RE (the luciferase reporter-expressing HIV-1 backbone) and pcDNA3.1-SARS-CoV-2-S (encoding for CoVs S protein) using VigoFect (Vigorous Biotechnology, Beijing, China). Pseudotyped particles were efficiently released in the supernatant. The supernatant was harvested at 72 h post-transfection, centrifuged at 3000 × g for 10 min, and frozen to −80 °C. To detect the inhibitory activity of a peptide on infection of coronavirus PsV, target cells (293T/ACE2 for SARS-CoV-2, SARS-CoV and SL-CoVs; RD cells for HCoV-OC43; Huh-7 for other CoVs) were plated at a density of 104 cells per well in a 96-well plate one day prior to infection. PsV was mixed with an equal volume of a peptide which was series diluted with PBS at 37 °C for 30 min. The mixture was transferred to the Huh-7 cells. Medium was changed after 12 h and incubation continued for 48 h. Luciferase activity was analyzed by the Luciferase Assay System (Promega, Madison, WI, USA).
    Anti-CoV activity in vivo:
    Reference:32231345
    Comment:
    3D structure:

    StructureACoVP100054

    Structure Experiment Verified:NO
    Similar Peptides:ACoVP100015   ACoVP100014   ACoVP100013   ACoVP100001   ACoVP100011