General information | |
ACovPid: | ACoVP100050 |
Trivial Name: | EK1 |
Amino Acids Sequence: | SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKEL |
Length: | 36 |
C-Terminal Modification: | None |
N-Terminal Modification: | None |
Chemical Modification: | None |
Peptide Source: | Human coronavirus OC43 (HCoV-OC43) : 31631 |
Source Description: | Peptide OC43-HR2P was derived from the HR2 domain of HCoV-OC43. EK1 was the optimized form of OC43-HR2P,and EK1C4 was the optimized form of EK1. |
Against Virus: | Human coronavirus NL63 (HCoV-NL63) : 277944 |
Inhibition Value Type: | IC50 |
Inhibitory Effect: | 7.666 |
Inhibitory Unit: | µM |
Target Domain Name: | HR1 domain of HCoV-NL63 |
Assay: | Pseudotyped virus infection inhibition assay |
Assay Description: | 293T cells were cotransfected with pNL4–3.luc.RE (the luciferase reporter-expressing HIV-1 backbone) and pcDNA3.1-SARS-CoV-2-S (encoding for CoVs S protein) using VigoFect (Vigorous Biotechnology, Beijing, China). Pseudotyped particles were efficiently released in the supernatant. The supernatant was harvested at 72 h post-transfection, centrifuged at 3000 × g for 10 min, and frozen to −80 °C. To detect the inhibitory activity of a peptide on infection of coronavirus PsV, target cells (293T/ACE2 for SARS-CoV-2, SARS-CoV and SL-CoVs; RD cells for HCoV-OC43; Huh-7 for other CoVs) were plated at a density of 104 cells per well in a 96-well plate one day prior to infection. PsV was mixed with an equal volume of a peptide which was series diluted with PBS at 37 °C for 30 min. The mixture was transferred to the Huh-7 cells. Medium was changed after 12 h and incubation continued for 48 h. Luciferase activity was analyzed by the Luciferase Assay System (Promega, Madison, WI, USA). |
Anti-CoV activity in vivo: | |
Reference: | 32231345 |
Comment: | |
3D structure: | |
Structure Experiment Verified: | NO |
Similar Peptides: | ACoVP100015   ACoVP100014   ACoVP100013   ACoVP100001   ACoVP100011 |
Target Domain information | |
Target Domain Full Name: | Heptad repeat 1 (HR1) domain of Human coronavirus NL63 (HCoV-NL63) spike glycoprotein |
Target Type: | glycoprotein |
UniprotID [Sequence]: | Q6Q1S2 [948-1067] |
Target Synonyms: | Alternative name(s) for spike glycoprotein: E2 Peplomer protein S glycoprotein |
Target Source: | Human coronavirus NL63 (HCoV-NL63) : 277944 |
Target Structure: | 2IEQ, 3KBH, 5SZS, 7KIP |