| General information | |
| ACovPid: | ACoVP100044 |
| Trivial Name: | EK1 |
| Amino Acids Sequence: | SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKEL |
| Length: | 36 |
| C-Terminal Modification: | None |
| N-Terminal Modification: | None |
| Chemical Modification: | None |
| Peptide Source: | Human coronavirus OC43 (HCoV-OC43) : 31631 |
| Source Description: | Peptide OC43-HR2P was derived from the HR2 domain of HCoV-OC43. EK1 was the optimized form of OC43-HR2P,and EK1C4 was the optimized form of EK1. |
| Against Virus: | |
| Inhibition Value Type: | IC50 |
| Inhibitory Effect: | 0.6318 |
| Inhibitory Unit: | µM |
| Target Domain Name: | |
| Assay: | Pseudotyped virus infection inhibition assay |
| Assay Description: | 293T cells were cotransfected with pNL4–3.luc.RE (the luciferase reporter-expressing HIV-1 backbone) and pcDNA3.1-SARS-CoV-2-S (encoding for CoVs S protein) using VigoFect (Vigorous Biotechnology, Beijing, China). Pseudotyped particles were efficiently released in the supernatant. The supernatant was harvested at 72 h post-transfection, centrifuged at 3000 × g for 10 min, and frozen to −80 °C. To detect the inhibitory activity of a peptide on infection of coronavirus PsV, target cells (293T/ACE2 for SARS-CoV-2, SARS-CoV and SL-CoVs; RD cells for HCoV-OC43; Huh-7 for other CoVs) were plated at a density of 104 cells per well in a 96-well plate one day prior to infection. PsV was mixed with an equal volume of a peptide which was series diluted with PBS at 37 °C for 30 min. The mixture was transferred to the Huh-7 cells. Medium was changed after 12 h and incubation continued for 48 h. Luciferase activity was analyzed by the Luciferase Assay System (Promega, Madison, WI, USA). |
| Anti-CoV activity in vivo: | |
| Reference: | 32231345 |
| Comment: | |
| 3D structure: | |
| Structure Experiment Verified: | NO |
| Similar Peptides: | ACoVP100015   ACoVP100014   ACoVP100013   ACoVP100001   ACoVP100011 |