General information
    ACovPid:ACoVP100037
    Trivial Name:EK1C4
    Amino Acids Sequence:SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGSG-PEG4-Chol
    Length:41
    C-Terminal Modification:Chol: cholesterol;  
    N-Terminal Modification:None
    Chemical Modification:PEG4: polyethylene glycol 4-based spacer;  
    Peptide Source:

    Human coronavirus OC43 (HCoV-OC43) : 31631

    Source Description:Peptide OC43-HR2P was derived from the HR2 domain of HCoV-OC43. EK1 was the optimized form of OC43-HR2P,and EK1C4 was the optimized form of EK1.
    Against Virus:

    Severe acute respiratory syndrome-like coronavirus Rs3367 (SL-CoV-Rs3367)

    Inhibition Value Type:IC50
    Inhibitory Effect:0.0081
    Inhibitory Unit:µM
    Target Domain Name:
    Assay:Cell–cell fusion assay
    Assay Description:The establishment and detection of several cell–cell fusion assays are as previously described. In brief, Huh-7 cells (for testing all coronaviruses) or 293T/ACE2 cells (for testing SARS-CoV-2) were used as target cells. For preparing effector cells expressing S protein a coronavirus, 293T cells were transfected with one of the S protein expression vectors, including 293T/SARS-CoV-2/GFP, 293T/MERS-CoV/GFP, 293T/HCoV-229E/GFP, 293T/SARS-CoV/GFP, or 293T/SL-CoV/GFP, 293T/HCoV-OC43/GFP, 293T/HCoV-NL63/GFP or empty plasmid pAAV-IRES-EGFP. For SARS-CoV S-, SL-CoV S-, OC43 S- or NL63 S-mediated cell–cell fusion assays, effector cells and target cells were cocultured in DMEM containing trypsin (80 ng/mL) for 4 h, while for SARS-CoV-2 and MERS-CoV S-mediated cell–cell fusion assays, effector cells and target cells were cocultured in DMEM without trypsin but 10% FBS for 2 h. After incubation, five fields were randomly selected in each well to count the number of fused and unfused cells under an inverted fluorescence microscope (Nikon Eclipse Ti-S).
    Anti-CoV activity in vivo:
    Reference:32231345
    Comment:
    3D structure:

    Structure Experiment Verified:
    Similar Peptides:ACoVP100011   ACoVP100010   ACoVP100009   ACoVP100008   ACoVP100007