General information | |
ACovPid: | ACoVP100035 |
Trivial Name: | EK1C4 |
Amino Acids Sequence: | SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGSG-PEG4-Chol |
Length: | 41 |
C-Terminal Modification: | Chol: cholesterol;   |
N-Terminal Modification: | None |
Chemical Modification: | PEG4: polyethylene glycol 4-based spacer;   |
Peptide Source: | Human coronavirus OC43 (HCoV-OC43) : 31631 |
Source Description: | Peptide OC43-HR2P was derived from the HR2 domain of HCoV-OC43. EK1 was the optimized form of OC43-HR2P,and EK1C4 was the optimized form of EK1. |
Against Virus: | Severe acute respiratory syndrome-like coronavirus WIV1 (SL-CoV-WIV1) |
Inhibition Value Type: | IC50 |
Inhibitory Effect: | 0.0045 |
Inhibitory Unit: | µM |
Target Domain Name: | |
Assay: | Cell–cell fusion assay |
Assay Description: | The establishment and detection of several cell–cell fusion assays are as previously described. In brief, Huh-7 cells (for testing all coronaviruses) or 293T/ACE2 cells (for testing SARS-CoV-2) were used as target cells. For preparing effector cells expressing S protein a coronavirus, 293T cells were transfected with one of the S protein expression vectors, including 293T/SARS-CoV-2/GFP, 293T/MERS-CoV/GFP, 293T/HCoV-229E/GFP, 293T/SARS-CoV/GFP, or 293T/SL-CoV/GFP, 293T/HCoV-OC43/GFP, 293T/HCoV-NL63/GFP or empty plasmid pAAV-IRES-EGFP. For SARS-CoV S-, SL-CoV S-, OC43 S- or NL63 S-mediated cell–cell fusion assays, effector cells and target cells were cocultured in DMEM containing trypsin (80 ng/mL) for 4 h, while for SARS-CoV-2 and MERS-CoV S-mediated cell–cell fusion assays, effector cells and target cells were cocultured in DMEM without trypsin but 10% FBS for 2 h. After incubation, five fields were randomly selected in each well to count the number of fused and unfused cells under an inverted fluorescence microscope (Nikon Eclipse Ti-S). |
Anti-CoV activity in vivo: | |
Reference: | 32231345 |
Comment: | |
3D structure: | |
Structure Experiment Verified: | |
Similar Peptides: | ACoVP100011   ACoVP100010   ACoVP100009   ACoVP100008   ACoVP100007 |